PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.I00442.1.p
Common NameEUGRSUZ_I00442, LOC104418273
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 338aa    MW: 37683.3 Da    PI: 6.9229
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.I00442.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.38.3e-191461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd++l++ ++++G g+W++ ++  g++R++k+c++rw +yl
  Eucgr.I00442.1.p 14 KGPWTPEEDQKLIKHIQKHGHGSWRALPKLAGLNRCGKSCRLRWTNYL 61
                      79********************************************97 PP

2Myb_DNA-binding55.31.5e-1767112148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg++++eE++ +++++  lG++ W++Ia +++ gRt++++k++w+++l
  Eucgr.I00442.1.p  67 RGKFSPEEEQTILNLHSILGNK-WSAIAGHLP-GRTDNEIKNFWNTHL 112
                       89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.4E-27564IPR009057Homeodomain-like
PROSITE profilePS5129418.744961IPR017930Myb domain
SuperFamilySSF466891.32E-3211108IPR009057Homeodomain-like
SMARTSM007173.5E-161363IPR001005SANT/Myb domain
PfamPF002498.0E-181461IPR001005SANT/Myb domain
CDDcd001673.02E-131661No hitNo description
PROSITE profilePS5129426.63862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.9E-2865117IPR009057Homeodomain-like
SMARTSM007171.9E-1666114IPR001005SANT/Myb domain
PfamPF002492.9E-1667112IPR001005SANT/Myb domain
CDDcd001672.04E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MGRSPCCDES GLKKGPWTPE EDQKLIKHIQ KHGHGSWRAL PKLAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF SPEEEQTILN LHSILGNKWS AIAGHLPGRT DNEIKNFWNT HLKKKLIQMG  120
FDPMTHRPRT DIFSSLPHLL ALVNLKELID HHSLEEQARL QAEAINKFQY LQYLLQPPTP  180
PVSLTPTTSN NVVTDDVETM KLLNAFASIK ENQMMTLSSS PSPSQLEATA HSLFGNAPVS  240
PVHDSYPFAH LPELQNPCSF QTNLSKDHDN NNNNTMVQAS EFAIFSQGEN SPNSPWLPSS  300
STPSPPAETS FTNTFNGDGG SVSSIWPDHL LDDFNFS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-30121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00503DAPTransfer from AT5G10280Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.I00442.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010027860.10.0PREDICTED: transcription factor MYB34-like
SwissprotQ8GWP02e-74MYB39_ARATH; Transcription factor MYB39
TrEMBLA0A059AKZ80.0A0A059AKZ8_EUCGR; Uncharacterized protein
STRINGPOPTR_0005s07590.11e-146(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10280.15e-99myb domain protein 92